Icon representing a puzzle

2243: Revisiting Puzzle 60: Beta Barrel

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,882
  2. Avatar for Go Science 2. Go Science 68 pts. 12,556
  3. Avatar for Contenders 3. Contenders 44 pts. 12,503
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 12,458
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 12,230
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 12,124
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,113
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 12,039
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 12,030
  10. Avatar for Team China 10. Team China 1 pt. 11,778

  1. Avatar for guineapig 31. guineapig Lv 1 9 pts. 11,911
  2. Avatar for Karlheinz 32. Karlheinz Lv 1 8 pts. 11,852
  3. Avatar for alcor29 33. alcor29 Lv 1 7 pts. 11,824
  4. Avatar for t.m.roach 34. t.m.roach Lv 1 7 pts. 11,822
  5. Avatar for Zhang Ruichong 35. Zhang Ruichong Lv 1 6 pts. 11,778
  6. Avatar for RichGuilmain 36. RichGuilmain Lv 1 5 pts. 11,770
  7. Avatar for roarshock 37. roarshock Lv 1 5 pts. 11,763
  8. Avatar for rezaefar 38. rezaefar Lv 1 4 pts. 11,751
  9. Avatar for Silvercraft 39. Silvercraft Lv 1 4 pts. 11,685
  10. Avatar for Trajan464 40. Trajan464 Lv 1 3 pts. 11,669

Comments