Placeholder image of a protein
Icon representing a puzzle

2247: Electron Density Reconstruction 22

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
January 01, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENE

Top groups


  1. Avatar for VeFold 11. VeFold 2 pts. 28,632
  2. Avatar for L'Alliance Francophone 12. L'Alliance Francophone 1 pt. 28,581
  3. Avatar for Australia 13. Australia 1 pt. 28,459
  4. Avatar for xkcd 14. xkcd 1 pt. 27,517
  5. Avatar for Czech National Team 15. Czech National Team 1 pt. 27,517
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 27,395
  7. Avatar for Firesign 17. Firesign 1 pt. 16,403

  1. Avatar for ProfVince 41. ProfVince Lv 1 3 pts. 28,571
  2. Avatar for Trajan464 42. Trajan464 Lv 1 3 pts. 28,528
  3. Avatar for ucad 43. ucad Lv 1 3 pts. 28,518
  4. Avatar for Gonegirl 44. Gonegirl Lv 1 2 pts. 28,512
  5. Avatar for blazegeek 45. blazegeek Lv 1 2 pts. 28,488
  6. Avatar for AlkiP0Ps 46. AlkiP0Ps Lv 1 2 pts. 28,459
  7. Avatar for Wiz kid 47. Wiz kid Lv 1 2 pts. 28,393
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 1 pt. 28,253
  9. Avatar for hada 49. hada Lv 1 1 pt. 28,183
  10. Avatar for carxo 50. carxo Lv 1 1 pt. 27,893

Comments


LociOiling Lv 1

This puzzle appears to be a replacement for puzzle 2244, which expired early: https://fold.it/puzzles/2013542

2247 is change to the usual puzzle schedule, because now we have a Sunday expiration (US time) in place of a Friday expiration. Not necessarily a bad thing.

Also, there are two puzzle 2247s at the moment, the other is this revisiting puzzle: https://fold.it/puzzles/2013547

Puzzle 2246 was skipped, so maybe the revisiting puzzle will become 2246 when everyone's back from holiday.

LociOiling Lv 1

Yes, this week's revisiting puzzle is now puzzle 2246. So everything looks more or less normal at the moment.

LociOiling Lv 1

As seen on some previous ED reconstruction puzzles, 2247 has four chains:

A: reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
B: geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene
C: reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
D: geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene

The whole thing forms a symmetric structure, but it's not a tetramer, or even a "dimer of dimers", since the chains are not identical.

AA Edit and related recipes won't be able to detect these chains, due to issues with atom numbering. Also, the initial "F" ("f" or phenylalanine) given in the puzzle comments is not present in the puzzle.

PDB 5YCT is a match, along with several others.

(Edit: four chains, not a dimer….)