Placeholder image of a protein
Icon representing a puzzle

2247: Electron Density Reconstruction 22

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
January 01, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 29,294
  2. Avatar for Go Science 2. Go Science 73 pts. 29,257
  3. Avatar for Contenders 3. Contenders 52 pts. 29,156
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 29,133
  5. Avatar for Hold My Beer 5. Hold My Beer 24 pts. 29,091
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 29,086
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 10 pts. 29,036
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 29,016
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 28,828
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 28,632

  1. Avatar for Swapper242 71. Swapper242 Lv 1 1 pt. 27,375
  2. Avatar for Crypto 72. Crypto Lv 1 1 pt. 27,343
  3. Avatar for harvardman 73. harvardman Lv 1 1 pt. 26,162
  4. Avatar for ritch 74. ritch Lv 1 1 pt. 25,407
  5. Avatar for goose121 75. goose121 Lv 1 1 pt. 23,857
  6. Avatar for furi0us 76. furi0us Lv 1 1 pt. 23,831
  7. Avatar for Metarya 77. Metarya Lv 1 1 pt. 16,881
  8. Avatar for Deleted player 78. Deleted player 1 pt. 16,647
  9. Avatar for RegnadKcin 79. RegnadKcin Lv 1 1 pt. 16,403
  10. Avatar for fpc 80. fpc Lv 1 1 pt. 16,403

Comments


LociOiling Lv 1

This puzzle appears to be a replacement for puzzle 2244, which expired early: https://fold.it/puzzles/2013542

2247 is change to the usual puzzle schedule, because now we have a Sunday expiration (US time) in place of a Friday expiration. Not necessarily a bad thing.

Also, there are two puzzle 2247s at the moment, the other is this revisiting puzzle: https://fold.it/puzzles/2013547

Puzzle 2246 was skipped, so maybe the revisiting puzzle will become 2246 when everyone's back from holiday.

LociOiling Lv 1

Yes, this week's revisiting puzzle is now puzzle 2246. So everything looks more or less normal at the moment.

LociOiling Lv 1

As seen on some previous ED reconstruction puzzles, 2247 has four chains:

A: reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
B: geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene
C: reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
D: geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene

The whole thing forms a symmetric structure, but it's not a tetramer, or even a "dimer of dimers", since the chains are not identical.

AA Edit and related recipes won't be able to detect these chains, due to issues with atom numbering. Also, the initial "F" ("f" or phenylalanine) given in the puzzle comments is not present in the puzzle.

PDB 5YCT is a match, along with several others.

(Edit: four chains, not a dimer….)