Placeholder image of a protein
Icon representing a puzzle

2247: Electron Density Reconstruction 22

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 01, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 29,294
  2. Avatar for Go Science 2. Go Science 73 pts. 29,257
  3. Avatar for Contenders 3. Contenders 52 pts. 29,156
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 29,133
  5. Avatar for Hold My Beer 5. Hold My Beer 24 pts. 29,091
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 29,086
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 10 pts. 29,036
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 29,016
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 28,828
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 28,632

  1. Avatar for vyndaquel 61. vyndaquel Lv 1 1 pt. 27,637
  2. Avatar for ChickenRocks432 62. ChickenRocks432 Lv 1 1 pt. 27,617
  3. Avatar for Vinara 63. Vinara Lv 1 1 pt. 27,617
  4. Avatar for Larini 64. Larini Lv 1 1 pt. 27,615
  5. Avatar for Hellcat6 65. Hellcat6 Lv 1 1 pt. 27,604
  6. Avatar for Mohoernchen 66. Mohoernchen Lv 1 1 pt. 27,575
  7. Avatar for futsall 67. futsall Lv 1 1 pt. 27,544
  8. Avatar for TgamesPi 68. TgamesPi Lv 1 1 pt. 27,517
  9. Avatar for MrTyphlosion1000 69. MrTyphlosion1000 Lv 1 1 pt. 27,457
  10. Avatar for Sammy3c2b1a0 70. Sammy3c2b1a0 Lv 1 1 pt. 27,395

Comments


LociOiling Lv 1

This puzzle appears to be a replacement for puzzle 2244, which expired early: https://fold.it/puzzles/2013542

2247 is change to the usual puzzle schedule, because now we have a Sunday expiration (US time) in place of a Friday expiration. Not necessarily a bad thing.

Also, there are two puzzle 2247s at the moment, the other is this revisiting puzzle: https://fold.it/puzzles/2013547

Puzzle 2246 was skipped, so maybe the revisiting puzzle will become 2246 when everyone's back from holiday.

LociOiling Lv 1

Yes, this week's revisiting puzzle is now puzzle 2246. So everything looks more or less normal at the moment.

LociOiling Lv 1

As seen on some previous ED reconstruction puzzles, 2247 has four chains:

A: reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
B: geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene
C: reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
D: geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene

The whole thing forms a symmetric structure, but it's not a tetramer, or even a "dimer of dimers", since the chains are not identical.

AA Edit and related recipes won't be able to detect these chains, due to issues with atom numbering. Also, the initial "F" ("f" or phenylalanine) given in the puzzle comments is not present in the puzzle.

PDB 5YCT is a match, along with several others.

(Edit: four chains, not a dimer….)