Placeholder image of a protein
Icon representing a puzzle

2250: Electron Density Reconstruction 23

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
January 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Of note, you may have seen this protein in puzzles before, but the structure is solved a bit differently here.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSALDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 27,147
  2. Avatar for Australia 12. Australia 1 pt. 27,076

  1. Avatar for MicElephant
    1. MicElephant Lv 1
    100 pts. 27,427
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 27,422
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 27,418
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 81 pts. 27,403
  5. Avatar for grogar7 5. grogar7 Lv 1 76 pts. 27,387
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 70 pts. 27,378
  7. Avatar for Timo van der Laan 7. Timo van der Laan Lv 1 65 pts. 27,368
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 60 pts. 27,362
  9. Avatar for gmn 9. gmn Lv 1 56 pts. 27,356
  10. Avatar for Galaxie 10. Galaxie Lv 1 52 pts. 27,352

Comments