Placeholder image of a protein
Icon representing a puzzle

2250: Electron Density Reconstruction 23

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
January 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Of note, you may have seen this protein in puzzles before, but the structure is solved a bit differently here.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSALDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups


  1. Avatar for Contenders 100 pts. 27,427
  2. Avatar for Go Science 2. Go Science 63 pts. 27,424
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 27,418
  4. Avatar for Void Crushers 4. Void Crushers 21 pts. 27,368
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 27,319
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 27,295
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 27,293
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 27,202
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 27,189
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 27,147

  1. Avatar for MicElephant
    1. MicElephant Lv 1
    100 pts. 27,425
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 52 pts. 27,424
  3. Avatar for LociOiling 3. LociOiling Lv 1 24 pts. 27,414
  4. Avatar for Galaxie 4. Galaxie Lv 1 10 pts. 27,413
  5. Avatar for gmn 5. gmn Lv 1 4 pts. 27,403
  6. Avatar for maithra 6. maithra Lv 1 1 pt. 27,382
  7. Avatar for jausmh 7. jausmh Lv 1 1 pt. 27,293
  8. Avatar for fpc 8. fpc Lv 1 1 pt. 27,267
  9. Avatar for Oransche 9. Oransche Lv 1 1 pt. 27,191

Comments