Placeholder image of a protein
Icon representing a puzzle

2250: Electron Density Reconstruction 23

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Of note, you may have seen this protein in puzzles before, but the structure is solved a bit differently here.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSALDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 27,427
  2. Avatar for Go Science 2. Go Science 63 pts. 27,424
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 27,418
  4. Avatar for Void Crushers 4. Void Crushers 21 pts. 27,368
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 27,319
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 27,295
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 27,293
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 27,202
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 27,189
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 27,147
  1. Avatar for Gonegirl 41. Gonegirl Lv 1 2 pts. 27,093
  2. Avatar for ProfVince 42. ProfVince Lv 1 2 pts. 27,089
  3. Avatar for Alistair69 43. Alistair69 Lv 1 2 pts. 27,078
  4. Avatar for Wiz kid 44. Wiz kid Lv 1 2 pts. 27,076
  5. Avatar for Oransche 45. Oransche Lv 1 1 pt. 27,029
  6. Avatar for hada 46. hada Lv 1 1 pt. 27,000
  7. Avatar for blazegeek 47. blazegeek Lv 1 1 pt. 26,935
  8. Avatar for AlkiP0Ps 48. AlkiP0Ps Lv 1 1 pt. 26,869
  9. Avatar for Skippysk8s 49. Skippysk8s Lv 1 1 pt. 26,809
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 1 pt. 26,795

Comments