Icon representing a puzzle

2252: Revisiting Puzzle 63: Spinach Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 10,588
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,437
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 51 pts. 11,119
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 48 pts. 11,100
  3. Avatar for AlphaFold2 13. AlphaFold2 Lv 1 44 pts. 11,086
  4. Avatar for Alistair69 14. Alistair69 Lv 1 41 pts. 11,050
  5. Avatar for grogar7 15. grogar7 Lv 1 38 pts. 11,038
  6. Avatar for Idiotboy 16. Idiotboy Lv 1 35 pts. 11,023
  7. Avatar for Gonegirl 17. Gonegirl Lv 1 33 pts. 11,003
  8. Avatar for gmn 18. gmn Lv 1 30 pts. 10,992
  9. Avatar for Joanna_H 19. Joanna_H Lv 1 28 pts. 10,977
  10. Avatar for hada 20. hada Lv 1 26 pts. 10,930

Comments