Icon representing a puzzle

2252: Revisiting Puzzle 63: Spinach Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 10,588
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,437
  1. Avatar for manu8170 41. manu8170 Lv 1 3 pts. 10,565
  2. Avatar for akaaka 42. akaaka Lv 1 3 pts. 10,497
  3. Avatar for ShadowTactics 43. ShadowTactics Lv 1 3 pts. 10,437
  4. Avatar for RichGuilmain 44. RichGuilmain Lv 1 2 pts. 10,396
  5. Avatar for stomjoh 45. stomjoh Lv 1 2 pts. 10,294
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 2 pts. 10,290
  7. Avatar for sitlux 47. sitlux Lv 1 2 pts. 10,233
  8. Avatar for phi16 48. phi16 Lv 1 2 pts. 10,223
  9. Avatar for Trajan464 49. Trajan464 Lv 1 1 pt. 10,149
  10. Avatar for Dr.Sillem 50. Dr.Sillem Lv 1 1 pt. 10,107

Comments