Icon representing a puzzle

2252: Revisiting Puzzle 63: Spinach Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 10,588
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,437
  1. Avatar for Karlheinz 51. Karlheinz Lv 1 1 pt. 10,104
  2. Avatar for pizpot 52. pizpot Lv 1 1 pt. 10,075
  3. Avatar for Wiz kid 53. Wiz kid Lv 1 1 pt. 10,071
  4. Avatar for ucad 54. ucad Lv 1 1 pt. 10,036
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 10,035
  6. Avatar for Silvercraft 56. Silvercraft Lv 1 1 pt. 10,027
  7. Avatar for DScott 57. DScott Lv 1 1 pt. 9,995
  8. Avatar for Merf 58. Merf Lv 1 1 pt. 9,953
  9. Avatar for t.m.roach 59. t.m.roach Lv 1 1 pt. 9,891
  10. Avatar for Porus 60. Porus Lv 1 1 pt. 9,556

Comments