Icon representing a puzzle

2252: Revisiting Puzzle 63: Spinach Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 10,588
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,437
  1. Avatar for Larini 61. Larini Lv 1 1 pt. 9,556
  2. Avatar for walenz 62. walenz Lv 1 1 pt. 8,935
  3. Avatar for roarshock 63. roarshock Lv 1 1 pt. 8,793
  4. Avatar for Oransche 64. Oransche Lv 1 1 pt. 8,727
  5. Avatar for BarrySampson 65. BarrySampson Lv 1 1 pt. 8,682
  6. Avatar for heather-1 66. heather-1 Lv 1 1 pt. 7,818
  7. Avatar for puxatudo 67. puxatudo Lv 1 1 pt. 7,731
  8. Avatar for zbp 68. zbp Lv 1 1 pt. 7,093
  9. Avatar for Mohoernchen 69. Mohoernchen Lv 1 1 pt. 6,732
  10. Avatar for rinze 70. rinze Lv 1 1 pt. 6,679

Comments