Icon representing a puzzle

2252: Revisiting Puzzle 63: Spinach Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 10,588
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,437
  1. Avatar for pruneau_44 71. pruneau_44 Lv 1 1 pt. 6,607
  2. Avatar for heyubob 72. heyubob Lv 1 1 pt. 6,513
  3. Avatar for bombcod 73. bombcod Lv 1 1 pt. 6,405
  4. Avatar for mart0258 74. mart0258 Lv 1 1 pt. 6,373
  5. Avatar for Swapper242 75. Swapper242 Lv 1 1 pt. 6,365
  6. Avatar for robgee 76. robgee Lv 1 1 pt. 6,329
  7. Avatar for vyndaquel 77. vyndaquel Lv 1 1 pt. 6,118
  8. Avatar for harvardman 78. harvardman Lv 1 1 pt. 5,850
  9. Avatar for Space Succs 79. Space Succs Lv 1 1 pt. 1,806
  10. Avatar for Kellyfelistas 80. Kellyfelistas Lv 1 1 pt. 0

Comments