Icon representing a puzzle

2252: Revisiting Puzzle 63: Spinach Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,337
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,313
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 11,169
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,157
  5. Avatar for Contenders 5. Contenders 11 pts. 11,123
  6. Avatar for AlphaFold 6. AlphaFold 5 pts. 11,086
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 10,977
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,868
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,797
  10. Avatar for Australia 10. Australia 1 pt. 10,760
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 11,337
  2. Avatar for Galaxie 2. Galaxie Lv 1 52 pts. 11,313
  3. Avatar for LociOiling 3. LociOiling Lv 1 24 pts. 11,308
  4. Avatar for alcor29 4. alcor29 Lv 1 10 pts. 11,261
  5. Avatar for Steven Pletsch 5. Steven Pletsch Lv 1 4 pts. 10,997
  6. Avatar for MicElephant 6. MicElephant Lv 1 1 pt. 10,931
  7. Avatar for maithra 7. maithra Lv 1 1 pt. 10,897
  8. Avatar for puxatudo 8. puxatudo Lv 1 1 pt. 10,812
  9. Avatar for fpc 9. fpc Lv 1 1 pt. 10,797

Comments