Placeholder image of a protein
Icon representing a puzzle

2261: Electron Density Reconstruction 26

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 02, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a couple copies of two proteins as well as peptides bound, so it will be a bit different than usual.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for OmHS 11. OmHS 1 pt. 29,339
  2. Avatar for VeFold 12. VeFold 1 pt. 28,759
  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 29,891
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 94 pts. 29,889
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 29,886
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 81 pts. 29,863
  5. Avatar for gmn 5. gmn Lv 1 76 pts. 29,842
  6. Avatar for grogar7 6. grogar7 Lv 1 70 pts. 29,842
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 65 pts. 29,837
  8. Avatar for MicElephant 8. MicElephant Lv 1 60 pts. 29,794
  9. Avatar for Galaxie 9. Galaxie Lv 1 56 pts. 29,791
  10. Avatar for drjr 10. drjr Lv 1 52 pts. 29,774

Comments

MicElephant Lv 1

Why don't you fix the crashes caused by the trim button before posting such puzzles? Problem report existing since months.