Placeholder image of a protein
Icon representing a puzzle

2261: Electron Density Reconstruction 26

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 02, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a couple copies of two proteins as well as peptides bound, so it will be a bit different than usual.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups


  1. Avatar for Go Science 100 pts. 29,895
  2. Avatar for Void Crushers 2. Void Crushers 63 pts. 29,889
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 29,886
  4. Avatar for Contenders 4. Contenders 21 pts. 29,794
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 29,762
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 29,632
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 29,621
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 29,574
  9. Avatar for Australia 9. Australia 1 pt. 29,509
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 29,430

  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 29,895
  2. Avatar for Galaxie 2. Galaxie Lv 1 47 pts. 29,883
  3. Avatar for phi16 3. phi16 Lv 1 19 pts. 29,883
  4. Avatar for LociOiling 4. LociOiling Lv 1 7 pts. 29,878
  5. Avatar for gmn 5. gmn Lv 1 2 pts. 29,858
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 1 pt. 29,836
  7. Avatar for toshiue 7. toshiue Lv 1 1 pt. 29,836
  8. Avatar for maithra 8. maithra Lv 1 1 pt. 29,629

Comments


MicElephant Lv 1

Why don't you fix the crashes caused by the trim button before posting such puzzles? Problem report existing since months.