Icon representing a puzzle

2260: Revisiting Puzzle 66: Cytochrome

Closed since about 3 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
February 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,003
  2. Avatar for Window Group 12. Window Group 1 pt. 8,275
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,737

  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 10,292
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 94 pts. 10,283
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 88 pts. 10,263
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 83 pts. 10,245
  5. Avatar for MicElephant 5. MicElephant Lv 1 78 pts. 10,238
  6. Avatar for Galaxie 6. Galaxie Lv 1 73 pts. 10,234
  7. Avatar for gmn 7. gmn Lv 1 68 pts. 10,230
  8. Avatar for LociOiling 8. LociOiling Lv 1 63 pts. 10,229
  9. Avatar for fpc 9. fpc Lv 1 59 pts. 10,217
  10. Avatar for grogar7 10. grogar7 Lv 1 55 pts. 10,217

Comments