Icon representing a puzzle

2260: Revisiting Puzzle 66: Cytochrome

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
February 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,003
  2. Avatar for Window Group 12. Window Group 1 pt. 8,275
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,737

  1. Avatar for Aubade01 11. Aubade01 Lv 1 51 pts. 10,216
  2. Avatar for g_b 12. g_b Lv 1 48 pts. 10,200
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 44 pts. 10,198
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 41 pts. 10,197
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 38 pts. 10,192
  6. Avatar for akaaka 16. akaaka Lv 1 35 pts. 10,185
  7. Avatar for guineapig 17. guineapig Lv 1 33 pts. 10,183
  8. Avatar for spmm 18. spmm Lv 1 30 pts. 10,182
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 28 pts. 10,177
  10. Avatar for NPrincipi 20. NPrincipi Lv 1 26 pts. 10,174

Comments