Icon representing a puzzle

2260: Revisiting Puzzle 66: Cytochrome

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
February 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,003
  2. Avatar for Window Group 12. Window Group 1 pt. 8,275
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,737

  1. Avatar for vyndaquel 71. vyndaquel Lv 1 1 pt. 9,448
  2. Avatar for Deleted player 72. Deleted player 1 pt. 9,414
  3. Avatar for Swapper242 73. Swapper242 Lv 1 1 pt. 9,413
  4. Avatar for el_Lechero 74. el_Lechero Lv 1 1 pt. 9,317
  5. Avatar for heyubob 75. heyubob Lv 1 1 pt. 8,998
  6. Avatar for jflat06 76. jflat06 Lv 1 1 pt. 8,275
  7. Avatar for RyosXe 77. RyosXe Lv 1 1 pt. 7,737
  8. Avatar for bkoep 78. bkoep Lv 1 1 pt. 7,737
  9. Avatar for Sciren 79. Sciren Lv 1 1 pt. 7,737
  10. Avatar for Sujana 80. Sujana Lv 1 1 pt. 7,737

Comments