Icon representing a puzzle

2260: Revisiting Puzzle 66: Cytochrome

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Go Science 100 pts. 10,287
  2. Avatar for Contenders 2. Contenders 65 pts. 10,238
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,237
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,217
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 10,198
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 10,192
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,177
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,124
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,048
  10. Avatar for OmHS 10. OmHS 1 pt. 10,044

  1. Avatar for maithra 21. maithra Lv 1 24 pts. 10,172
  2. Avatar for BackBuffer 22. BackBuffer Lv 1 22 pts. 10,157
  3. Avatar for BootsMcGraw 23. BootsMcGraw Lv 1 20 pts. 10,156
  4. Avatar for phi16 24. phi16 Lv 1 18 pts. 10,147
  5. Avatar for toshiue 25. toshiue Lv 1 17 pts. 10,141
  6. Avatar for alcor29 26. alcor29 Lv 1 15 pts. 10,140
  7. Avatar for Bletchley Park 27. Bletchley Park Lv 1 14 pts. 10,139
  8. Avatar for Joanna_H 28. Joanna_H Lv 1 13 pts. 10,124
  9. Avatar for Kiwegapa 29. Kiwegapa Lv 1 12 pts. 10,089
  10. Avatar for ProfVince 30. ProfVince Lv 1 11 pts. 10,089

Comments