Icon representing a puzzle

2260: Revisiting Puzzle 66: Cytochrome

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Go Science 100 pts. 10,287
  2. Avatar for Contenders 2. Contenders 65 pts. 10,238
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,237
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,217
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 10,198
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 10,192
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,177
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,124
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,048
  10. Avatar for OmHS 10. OmHS 1 pt. 10,044

  1. Avatar for Idiotboy 31. Idiotboy Lv 1 10 pts. 10,088
  2. Avatar for equilibria 32. equilibria Lv 1 9 pts. 10,065
  3. Avatar for ShadowTactics 33. ShadowTactics Lv 1 8 pts. 10,048
  4. Avatar for Kayceecyr65 34. Kayceecyr65 Lv 1 7 pts. 10,044
  5. Avatar for Steven Pletsch 35. Steven Pletsch Lv 1 6 pts. 10,016
  6. Avatar for blazegeek 36. blazegeek Lv 1 6 pts. 10,010
  7. Avatar for AlkiP0Ps 37. AlkiP0Ps Lv 1 5 pts. 10,003
  8. Avatar for stomjoh 38. stomjoh Lv 1 5 pts. 9,973
  9. Avatar for bamh 39. bamh Lv 1 4 pts. 9,971
  10. Avatar for Wiz kid 40. Wiz kid Lv 1 4 pts. 9,959

Comments