Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since almost 3 years ago

Beginner

Summary


Created
February 10, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups


  1. Avatar for BIOB101 - Discover Biology 100 pts. 7,950
  2. Avatar for Go Science 2. Go Science 56 pts. 7,950
  3. Avatar for SHELL 3. SHELL 29 pts. 7,655
  4. Avatar for Villanova ChE 4. Villanova ChE 14 pts. 6,466
  5. Avatar for Street Smarts 5. Street Smarts 6 pts. 6,426
  6. Avatar for chgf.vu.lt 6. chgf.vu.lt 2 pts. 1,837
  7. Avatar for Protein Boiz 7. Protein Boiz 1 pt. 0
  8. Avatar for Boilermakers 8. Boilermakers 1 pt. 0
  9. Avatar for Haykapnayan 9. Haykapnayan 1 pt. 0
  10. Avatar for Tableau ACE 10. Tableau ACE 1 pt. 0

No scores of this type to display!

Comments