Placeholder image of a protein
Icon representing a puzzle

2268: Electron Density Reconstruction 28

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle that have the same sequence.

Sequence
SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNESDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNE

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 27,449
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 26,868
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 26,573
  4. Avatar for BIOB101 - Discover Biology 14. BIOB101 - Discover Biology 1 pt. 25,263
  5. Avatar for SHELL 15. SHELL 1 pt. 18,744
  6. Avatar for Window Group 16. Window Group 1 pt. 10,965
  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 28,181
  2. Avatar for grogar7 2. grogar7 Lv 1 95 pts. 28,172
  3. Avatar for LociOiling 3. LociOiling Lv 1 89 pts. 28,169
  4. Avatar for Punzi Baker 3 4. Punzi Baker 3 Lv 1 83 pts. 28,155
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 78 pts. 28,127
  6. Avatar for guineapig 6. guineapig Lv 1 74 pts. 28,117
  7. Avatar for phi16 7. phi16 Lv 1 69 pts. 28,080
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 65 pts. 28,078
  9. Avatar for MicElephant 9. MicElephant Lv 1 60 pts. 28,070
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 56 pts. 28,061

Comments

LociOiling Lv 1

Looks like two chains this time:

sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlell    (1 -  85)
sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlellne (86 - 172)

Once again AA Edit and other recipes fail to detect the chains, but soon….

grogar7 Lv 1

So both the puzzle description and the sequence quoted in the description are incorrect. The chains are not identical. Chain #1 is lacking the 'ne' end. So chain #1 is 85 residues and chain #2 is 87 residues.