Placeholder image of a protein
Icon representing a puzzle

2268: Electron Density Reconstruction 28

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle that have the same sequence.

Sequence
SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNESDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 28,185
  2. Avatar for Go Science 2. Go Science 71 pts. 28,184
  3. Avatar for Contenders 3. Contenders 49 pts. 28,117
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 33 pts. 27,967
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 27,966
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 27,949
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 27,817
  8. Avatar for OmHS 8. OmHS 5 pts. 27,604
  9. Avatar for VeFold 9. VeFold 2 pts. 27,482
  10. Avatar for AlphaFold 10. AlphaFold 3 pts. 27,482

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 28,185
  2. Avatar for LociOiling 2. LociOiling Lv 1 56 pts. 28,185
  3. Avatar for silent gene 3. silent gene Lv 1 29 pts. 28,184
  4. Avatar for phi16 4. phi16 Lv 1 14 pts. 28,183
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 6 pts. 28,183
  6. Avatar for Sandrix72 6. Sandrix72 Lv 1 2 pts. 28,180
  7. Avatar for Steven Pletsch 7. Steven Pletsch Lv 1 1 pt. 28,179
  8. Avatar for alcor29 8. alcor29 Lv 1 1 pt. 28,169
  9. Avatar for hansvandenhof 9. hansvandenhof Lv 1 1 pt. 28,122
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 1 pt. 28,069

Comments


LociOiling Lv 1

Looks like two chains this time:

sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlell    (1 -  85)
sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlellne (86 - 172)

Once again AA Edit and other recipes fail to detect the chains, but soon….

grogar7 Lv 1

So both the puzzle description and the sequence quoted in the description are incorrect. The chains are not identical. Chain #1 is lacking the 'ne' end. So chain #1 is 85 residues and chain #2 is 87 residues.