Placeholder image of a protein
Icon representing a puzzle

2268: Electron Density Reconstruction 28

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle that have the same sequence.

Sequence
SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNESDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 28,185
  2. Avatar for Go Science 2. Go Science 71 pts. 28,184
  3. Avatar for Contenders 3. Contenders 49 pts. 28,117
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 33 pts. 27,967
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 27,966
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 27,949
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 27,817
  8. Avatar for OmHS 8. OmHS 5 pts. 27,604
  9. Avatar for VeFold 9. VeFold 2 pts. 27,482
  10. Avatar for AlphaFold 10. AlphaFold 3 pts. 27,482

  1. Avatar for Swapper242 71. Swapper242 Lv 1 1 pt. 23,428
  2. Avatar for DaryMerkaat29 72. DaryMerkaat29 Lv 1 1 pt. 19,031
  3. Avatar for 42022092 73. 42022092 Lv 1 1 pt. 18,744
  4. Avatar for WuWTq 74. WuWTq Lv 1 1 pt. 13,727
  5. Avatar for ZionChris 75. ZionChris Lv 1 1 pt. 11,539
  6. Avatar for corbinwhan 76. corbinwhan Lv 1 1 pt. 11,085
  7. Avatar for lexibergman 77. lexibergman Lv 1 1 pt. 11,028
  8. Avatar for glebk 78. glebk Lv 1 1 pt. 10,965
  9. Avatar for pumpkinowl 79. pumpkinowl Lv 1 1 pt. 10,965
  10. Avatar for NOOOOBL 80. NOOOOBL Lv 1 1 pt. 10,965

Comments


LociOiling Lv 1

Looks like two chains this time:

sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlell    (1 -  85)
sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlellne (86 - 172)

Once again AA Edit and other recipes fail to detect the chains, but soon….

grogar7 Lv 1

So both the puzzle description and the sequence quoted in the description are incorrect. The chains are not identical. Chain #1 is lacking the 'ne' end. So chain #1 is 85 residues and chain #2 is 87 residues.