Placeholder image of a protein
Icon representing a puzzle

2271: Electron Density Reconstruction 29

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 28, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has several chains and is a bit larger than usual, so the Trim tool is recommended. The sequences are:
Chains A C E G
GSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQPA
Chains B D F H
NGPAVQFFKGKNGSADQVILVTQ

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 78,312
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 76,901
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 61,309
  4. Avatar for Window Group 14. Window Group 1 pt. 27,177

  1. Avatar for Merf 51. Merf Lv 1 1 pt. 74,902
  2. Avatar for zbp 52. zbp Lv 1 1 pt. 74,234
  3. Avatar for carxo 53. carxo Lv 1 1 pt. 73,459
  4. Avatar for Dr.Sillem 54. Dr.Sillem Lv 1 1 pt. 73,110
  5. Avatar for Mohoernchen 55. Mohoernchen Lv 1 1 pt. 73,099
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 72,899
  7. Avatar for hansvandenhof 57. hansvandenhof Lv 1 1 pt. 72,722
  8. Avatar for Larini 58. Larini Lv 1 1 pt. 72,647
  9. Avatar for WuWTq 59. WuWTq Lv 1 1 pt. 72,380
  10. Avatar for deathbat_87 60. deathbat_87 Lv 1 1 pt. 71,847

Comments


LociOiling Lv 1

This week's monster puzzle features a total of eight chains, including four large chains and four small chains.

AA Edit once again fails to do it justice, but it does recognize two chains.

The puzzle is a match for PDB 5TGH and related entries (5TGI, 5TGJ, and maybe others).

The long chains are all similar, but two end with alanine, and two don't.

Similarly, the short chains are similar, but two have glutamine at the end and two don't.

Here's what the chains would look like if AA Edit were a bit smarter:

slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqp
pavqffkgkngsadqvilvtq
slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqp
pavqffkgkngsadqvilvtq
slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqpa
pavqffkgkngsadqvilvt
slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqpa
pavqffkgkngsadqvilvt

(Note: the chains can be scrolled horizontally, there's a very thin scroll bar just above^^^^)