Placeholder image of a protein
Icon representing a puzzle

2271: Electron Density Reconstruction 29

Closed since about 3 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 28, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has several chains and is a bit larger than usual, so the Trim tool is recommended. The sequences are:
Chains A C E G
GSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQPA
Chains B D F H
NGPAVQFFKGKNGSADQVILVTQ

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 78,312
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 76,901
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 61,309
  4. Avatar for Window Group 14. Window Group 1 pt. 27,177

  1. Avatar for abiogenesis 61. abiogenesis Lv 1 1 pt. 71,469
  2. Avatar for pruneau_44 62. pruneau_44 Lv 1 1 pt. 70,501
  3. Avatar for heyubob 63. heyubob Lv 1 1 pt. 70,417
  4. Avatar for Sammy3c2b1a0 64. Sammy3c2b1a0 Lv 1 1 pt. 61,309
  5. Avatar for furi0us 65. furi0us Lv 1 1 pt. 57,292
  6. Avatar for DScott 66. DScott Lv 1 1 pt. 52,144
  7. Avatar for Swapper242 67. Swapper242 Lv 1 1 pt. 42,374
  8. Avatar for roarshock 68. roarshock Lv 1 1 pt. 41,450
  9. Avatar for jflat06 69. jflat06 Lv 1 1 pt. 27,177
  10. Avatar for spvincent 70. spvincent Lv 1 1 pt. 26,906

Comments


LociOiling Lv 1

This week's monster puzzle features a total of eight chains, including four large chains and four small chains.

AA Edit once again fails to do it justice, but it does recognize two chains.

The puzzle is a match for PDB 5TGH and related entries (5TGI, 5TGJ, and maybe others).

The long chains are all similar, but two end with alanine, and two don't.

Similarly, the short chains are similar, but two have glutamine at the end and two don't.

Here's what the chains would look like if AA Edit were a bit smarter:

slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqp
pavqffkgkngsadqvilvtq
slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqp
pavqffkgkngsadqvilvtq
slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqpa
pavqffkgkngsadqvilvt
slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqpa
pavqffkgkngsadqvilvt

(Note: the chains can be scrolled horizontally, there's a very thin scroll bar just above^^^^)