Placeholder image of a protein
Icon representing a puzzle

2271: Electron Density Reconstruction 29

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 28, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has several chains and is a bit larger than usual, so the Trim tool is recommended. The sequences are:
Chains A C E G
GSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQPA
Chains B D F H
NGPAVQFFKGKNGSADQVILVTQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 81,009
  2. Avatar for Go Science 2. Go Science 68 pts. 80,937
  3. Avatar for Contenders 3. Contenders 44 pts. 80,562
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 80,148
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 80,138
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 79,884
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 79,850
  8. Avatar for Australia 8. Australia 3 pts. 79,026
  9. Avatar for VeFold 9. VeFold 1 pt. 78,396
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 78,396
  1. Avatar for silent gene 21. silent gene Lv 1 19 pts. 79,728
  2. Avatar for g_b 22. g_b Lv 1 17 pts. 79,719
  3. Avatar for bamh 23. bamh Lv 1 15 pts. 79,706
  4. Avatar for guineapig 24. guineapig Lv 1 14 pts. 79,679
  5. Avatar for fpc 25. fpc Lv 1 12 pts. 79,625
  6. Avatar for BackBuffer 26. BackBuffer Lv 1 11 pts. 79,600
  7. Avatar for phi16 27. phi16 Lv 1 10 pts. 79,530
  8. Avatar for equilibria 28. equilibria Lv 1 9 pts. 79,043
  9. Avatar for AlkiP0Ps 29. AlkiP0Ps Lv 1 8 pts. 79,026
  10. Avatar for stomjoh 30. stomjoh Lv 1 7 pts. 78,975

Comments

LociOiling Lv 1

This week's monster puzzle features a total of eight chains, including four large chains and four small chains.

AA Edit once again fails to do it justice, but it does recognize two chains.

The puzzle is a match for PDB 5TGH and related entries (5TGI, 5TGJ, and maybe others).

The long chains are all similar, but two end with alanine, and two don't.

Similarly, the short chains are similar, but two have glutamine at the end and two don't.

Here's what the chains would look like if AA Edit were a bit smarter:

slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqp
pavqffkgkngsadqvilvtq
slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqp
pavqffkgkngsadqvilvtq
slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqpa
pavqffkgkngsadqvilvt
slqidipdalserdkvkftvhtkttlptfqspefsvtrqhedfvwlhdtliettdyagliippaptkpdfdgprekmqklgegegsmtkeefakmkqeleaeylavfkktvsshevflqrlsshpvlskdrnfhvfleydqpa
pavqffkgkngsadqvilvt

(Note: the chains can be scrolled horizontally, there's a very thin scroll bar just above^^^^)