Icon representing a puzzle

2272: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
March 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,196
  2. Avatar for VeFold 12. VeFold 1 pt. 9,770
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,960
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 93 pts. 10,926
  3. Avatar for MicElephant 3. MicElephant Lv 1 86 pts. 10,921
  4. Avatar for Galaxie 4. Galaxie Lv 1 80 pts. 10,918
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 74 pts. 10,874
  6. Avatar for gmn 6. gmn Lv 1 68 pts. 10,848
  7. Avatar for WBarme1234 7. WBarme1234 Lv 1 63 pts. 10,832
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 58 pts. 10,830
  9. Avatar for silent gene 9. silent gene Lv 1 53 pts. 10,777
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 49 pts. 10,741

Comments