Icon representing a puzzle

2272: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
March 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,963
  2. Avatar for Contenders 2. Contenders 63 pts. 10,921
  3. Avatar for Go Science 3. Go Science 37 pts. 10,874
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 10,832
  5. Avatar for Gargleblasters 5. Gargleblasters 11 pts. 10,635
  6. Avatar for Void Crushers 6. Void Crushers 5 pts. 10,631
  7. Avatar for Australia 7. Australia 2 pts. 10,622
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 1 pt. 10,573
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,524
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,308
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,963
  2. Avatar for LociOiling 2. LociOiling Lv 1 47 pts. 10,958
  3. Avatar for phi16 3. phi16 Lv 1 19 pts. 10,952
  4. Avatar for gmn 4. gmn Lv 1 7 pts. 10,932
  5. Avatar for alcor29 5. alcor29 Lv 1 2 pts. 10,924
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 1 pt. 10,872
  7. Avatar for silent gene 7. silent gene Lv 1 1 pt. 10,854
  8. Avatar for Oransche 8. Oransche Lv 1 1 pt. 10,516

Comments