Icon representing a puzzle

2272: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
March 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,963
  2. Avatar for Contenders 2. Contenders 63 pts. 10,921
  3. Avatar for Go Science 3. Go Science 37 pts. 10,874
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 10,832
  5. Avatar for Gargleblasters 5. Gargleblasters 11 pts. 10,635
  6. Avatar for Void Crushers 6. Void Crushers 5 pts. 10,631
  7. Avatar for Australia 7. Australia 2 pts. 10,622
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 1 pt. 10,573
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,524
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,308
  1. Avatar for AlkiP0Ps 21. AlkiP0Ps Lv 1 17 pts. 10,622
  2. Avatar for roarshock 22. roarshock Lv 1 16 pts. 10,611
  3. Avatar for BackBuffer 23. BackBuffer Lv 1 14 pts. 10,604
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 13 pts. 10,573
  5. Avatar for fpc 25. fpc Lv 1 11 pts. 10,524
  6. Avatar for bamh 26. bamh Lv 1 10 pts. 10,434
  7. Avatar for blazegeek 27. blazegeek Lv 1 9 pts. 10,426
  8. Avatar for hansvandenhof 28. hansvandenhof Lv 1 8 pts. 10,407
  9. Avatar for RichGuilmain 29. RichGuilmain Lv 1 7 pts. 10,406
  10. Avatar for Oransche 30. Oransche Lv 1 6 pts. 10,392

Comments