Icon representing a puzzle

2275: Revisiting Puzzle 71: Crystallin

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
March 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 2 pts. 10,597
  2. Avatar for VeFold 12. VeFold 1 pt. 10,351
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,162
  4. Avatar for SHELL 14. SHELL 1 pt. 10,049
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 10,017
  6. Avatar for Andrew's Foldit group 16. Andrew's Foldit group 1 pt. 9,842
  7. Avatar for Street Smarts 17. Street Smarts 1 pt. 9,666
  8. Avatar for WSU Bioc Spring 2016 18. WSU Bioc Spring 2016 1 pt. 8,970
  1. Avatar for Galaxie 11. Galaxie Lv 1 58 pts. 11,060
  2. Avatar for Punzi Baker 3 12. Punzi Baker 3 Lv 1 55 pts. 11,056
  3. Avatar for crpainter 13. crpainter Lv 1 52 pts. 11,021
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 49 pts. 10,991
  5. Avatar for g_b 15. g_b Lv 1 46 pts. 10,970
  6. Avatar for drjr 16. drjr Lv 1 43 pts. 10,947
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 41 pts. 10,940
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 38 pts. 10,900
  9. Avatar for Oransche 19. Oransche Lv 1 36 pts. 10,898
  10. Avatar for guineapig 20. guineapig Lv 1 34 pts. 10,881

Comments