Icon representing a puzzle

2275: Revisiting Puzzle 71: Crystallin

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
March 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 2 pts. 10,597
  2. Avatar for VeFold 12. VeFold 1 pt. 10,351
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,162
  4. Avatar for SHELL 14. SHELL 1 pt. 10,049
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 10,017
  6. Avatar for Andrew's Foldit group 16. Andrew's Foldit group 1 pt. 9,842
  7. Avatar for Street Smarts 17. Street Smarts 1 pt. 9,666
  8. Avatar for WSU Bioc Spring 2016 18. WSU Bioc Spring 2016 1 pt. 8,970

  1. Avatar for maithra 21. maithra Lv 1 32 pts. 10,879
  2. Avatar for ProfVince 22. ProfVince Lv 1 30 pts. 10,871
  3. Avatar for ShadowTactics 23. ShadowTactics Lv 1 28 pts. 10,861
  4. Avatar for silent gene 24. silent gene Lv 1 26 pts. 10,833
  5. Avatar for RichGuilmain 25. RichGuilmain Lv 1 24 pts. 10,828
  6. Avatar for Steven Pletsch 26. Steven Pletsch Lv 1 23 pts. 10,789
  7. Avatar for gmn 27. gmn Lv 1 21 pts. 10,781
  8. Avatar for MicElephant 28. MicElephant Lv 1 20 pts. 10,749
  9. Avatar for fpc 29. fpc Lv 1 18 pts. 10,721
  10. Avatar for heather-1 30. heather-1 Lv 1 17 pts. 10,715

Comments