Icon representing a puzzle

2275: Revisiting Puzzle 71: Crystallin

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
March 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Go Science 100 pts. 11,224
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,215
  3. Avatar for Marvin's bunch 3. Marvin's bunch 54 pts. 11,097
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 11,062
  5. Avatar for Contenders 5. Contenders 27 pts. 10,991
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 10,900
  7. Avatar for BOINC@Poland 7. BOINC@Poland 12 pts. 10,861
  8. Avatar for Australia 8. Australia 8 pts. 10,704
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 10,704
  10. Avatar for AlphaFold 10. AlphaFold 3 pts. 10,692

  1. Avatar for Galaxie 11. Galaxie Lv 1 58 pts. 11,060
  2. Avatar for Punzi Baker 3 12. Punzi Baker 3 Lv 1 55 pts. 11,056
  3. Avatar for crpainter 13. crpainter Lv 1 52 pts. 11,021
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 49 pts. 10,991
  5. Avatar for g_b 15. g_b Lv 1 46 pts. 10,970
  6. Avatar for drjr 16. drjr Lv 1 43 pts. 10,947
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 41 pts. 10,940
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 38 pts. 10,900
  9. Avatar for Oransche 19. Oransche Lv 1 36 pts. 10,898
  10. Avatar for guineapig 20. guineapig Lv 1 34 pts. 10,881

Comments