Icon representing a puzzle

2275: Revisiting Puzzle 71: Crystallin

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
March 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Go Science 100 pts. 11,224
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,215
  3. Avatar for Marvin's bunch 3. Marvin's bunch 54 pts. 11,097
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 11,062
  5. Avatar for Contenders 5. Contenders 27 pts. 10,991
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 10,900
  7. Avatar for BOINC@Poland 7. BOINC@Poland 12 pts. 10,861
  8. Avatar for Australia 8. Australia 8 pts. 10,704
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 10,704
  10. Avatar for AlphaFold 10. AlphaFold 3 pts. 10,692

  1. Avatar for AlkiP0Ps 31. AlkiP0Ps Lv 1 16 pts. 10,704
  2. Avatar for Timo van der Laan 32. Timo van der Laan Lv 1 15 pts. 10,704
  3. Avatar for equilibria 33. equilibria Lv 1 14 pts. 10,694
  4. Avatar for AlphaFold2 34. AlphaFold2 Lv 1 13 pts. 10,692
  5. Avatar for NPrincipi 35. NPrincipi Lv 1 12 pts. 10,682
  6. Avatar for ucad 36. ucad Lv 1 11 pts. 10,676
  7. Avatar for hada 37. hada Lv 1 10 pts. 10,666
  8. Avatar for Wiz kid 38. Wiz kid Lv 1 9 pts. 10,665
  9. Avatar for Vinara 39. Vinara Lv 1 9 pts. 10,654
  10. Avatar for strong_base 40. strong_base Lv 1 8 pts. 10,634

Comments