Icon representing a puzzle

2275: Revisiting Puzzle 71: Crystallin

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
March 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Go Science 100 pts. 11,224
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,215
  3. Avatar for Marvin's bunch 3. Marvin's bunch 54 pts. 11,097
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 11,062
  5. Avatar for Contenders 5. Contenders 27 pts. 10,991
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 10,900
  7. Avatar for BOINC@Poland 7. BOINC@Poland 12 pts. 10,861
  8. Avatar for Australia 8. Australia 8 pts. 10,704
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 10,704
  10. Avatar for AlphaFold 10. AlphaFold 3 pts. 10,692

  1. Avatar for zbp 61. zbp Lv 1 1 pt. 10,206
  2. Avatar for drumpeter18yrs9yrs 62. drumpeter18yrs9yrs Lv 1 1 pt. 10,199
  3. Avatar for Larini 63. Larini Lv 1 1 pt. 10,182
  4. Avatar for alyssa_d_V2.0 64. alyssa_d_V2.0 Lv 1 1 pt. 10,162
  5. Avatar for lconor 65. lconor Lv 1 1 pt. 10,147
  6. Avatar for nice69 66. nice69 Lv 1 1 pt. 10,107
  7. Avatar for Dr.Sillem 67. Dr.Sillem Lv 1 1 pt. 10,102
  8. Avatar for DScott 68. DScott Lv 1 1 pt. 10,053
  9. Avatar for luobochitu 69. luobochitu Lv 1 1 pt. 10,049
  10. Avatar for muffnerk 70. muffnerk Lv 1 1 pt. 10,019

Comments