Icon representing a puzzle

2275: Revisiting Puzzle 71: Crystallin

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
March 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Go Science 100 pts. 11,224
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,215
  3. Avatar for Marvin's bunch 3. Marvin's bunch 54 pts. 11,097
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 11,062
  5. Avatar for Contenders 5. Contenders 27 pts. 10,991
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 10,900
  7. Avatar for BOINC@Poland 7. BOINC@Poland 12 pts. 10,861
  8. Avatar for Australia 8. Australia 8 pts. 10,704
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 10,704
  10. Avatar for AlphaFold 10. AlphaFold 3 pts. 10,692

  1. Avatar for U202240409 81. U202240409 Lv 1 1 pt. 9,659
  2. Avatar for estivat 82. estivat Lv 1 1 pt. 9,659
  3. Avatar for froschi2 83. froschi2 Lv 1 1 pt. 9,627
  4. Avatar for WuWTq 84. WuWTq Lv 1 1 pt. 9,599
  5. Avatar for oro.luc.2002 85. oro.luc.2002 Lv 1 1 pt. 9,571
  6. Avatar for Swapper242 86. Swapper242 Lv 1 1 pt. 9,557
  7. Avatar for xw 87. xw Lv 1 1 pt. 9,550
  8. Avatar for furi0us 88. furi0us Lv 1 1 pt. 9,524
  9. Avatar for DipsyDoodle2016 89. DipsyDoodle2016 Lv 1 1 pt. 9,482
  10. Avatar for RicardoGiron 90. RicardoGiron Lv 1 1 pt. 9,257

Comments