Icon representing a puzzle

2275: Revisiting Puzzle 71: Crystallin

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
March 13, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,224
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,215
  3. Avatar for Marvin's bunch 3. Marvin's bunch 54 pts. 11,097
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 11,062
  5. Avatar for Contenders 5. Contenders 27 pts. 10,991
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 10,900
  7. Avatar for BOINC@Poland 7. BOINC@Poland 12 pts. 10,861
  8. Avatar for Australia 8. Australia 8 pts. 10,704
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 10,704
  10. Avatar for AlphaFold 10. AlphaFold 3 pts. 10,692
  1. Avatar for Alistair69 41. Alistair69 Lv 1 7 pts. 10,618
  2. Avatar for phi16 42. phi16 Lv 1 7 pts. 10,604
  3. Avatar for Idiotboy 43. Idiotboy Lv 1 6 pts. 10,597
  4. Avatar for Joanna_H 44. Joanna_H Lv 1 6 pts. 10,597
  5. Avatar for alcor29 45. alcor29 Lv 1 5 pts. 10,597
  6. Avatar for georg137 46. georg137 Lv 1 5 pts. 10,594
  7. Avatar for dcc5480 47. dcc5480 Lv 1 4 pts. 10,564
  8. Avatar for rosie4loop 48. rosie4loop Lv 1 4 pts. 10,436
  9. Avatar for blazegeek 49. blazegeek Lv 1 4 pts. 10,420
  10. Avatar for jadephoenix 50. jadephoenix Lv 1 3 pts. 10,419

Comments