Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner

Summary

Created
March 20, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Die Bigbrains 11. Die Bigbrains 1 pt. 11,405
  1. Avatar for ChemBi 91. ChemBi Lv 1 4 pts. 11,514
  2. Avatar for apw0038 92. apw0038 Lv 1 4 pts. 11,514
  3. Avatar for Aastha kale 93. Aastha kale Lv 1 3 pts. 11,514
  4. Avatar for FlorianReddel 94. FlorianReddel Lv 1 3 pts. 11,507
  5. Avatar for _cathyyy_18 95. _cathyyy_18 Lv 1 3 pts. 11,506
  6. Avatar for cdd0045 96. cdd0045 Lv 1 3 pts. 11,485
  7. Avatar for micelkiwie 97. micelkiwie Lv 1 3 pts. 11,451
  8. Avatar for umairah kamil 98. umairah kamil Lv 1 3 pts. 11,447
  9. Avatar for LizaPryor 99. LizaPryor Lv 1 3 pts. 11,429
  10. Avatar for Ian Schnatterly 100. Ian Schnatterly Lv 1 2 pts. 11,420

Comments