Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner

Summary


Created
March 20, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


  1. Avatar for Die Bigbrains 11. Die Bigbrains 1 pt. 11,405

  1. Avatar for Paulina1234 101. Paulina1234 Lv 1 2 pts. 11,415
  2. Avatar for Deleted player 102. Deleted player 2 pts. 11,411
  3. Avatar for GuiguiT 103. GuiguiT Lv 1 2 pts. 11,407
  4. Avatar for Asoto10 104. Asoto10 Lv 1 2 pts. 11,406
  5. Avatar for Bernard 105. Bernard Lv 1 1 pt. 11,405
  6. Avatar for Deleted player 106. Deleted player pts. 11,405
  7. Avatar for Druga 107. Druga Lv 1 1 pt. 11,405
  8. Avatar for schthprtkrn 108. schthprtkrn Lv 1 2 pts. 11,405
  9. Avatar for Piyanan 109. Piyanan Lv 1 1 pt. 11,405
  10. Avatar for 1984editor 110. 1984editor Lv 1 1 pt. 11,405

Comments