Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner

Summary

Created
March 20, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Die Bigbrains 11. Die Bigbrains 1 pt. 11,405
  1. Avatar for swimbrim 111. swimbrim Lv 1 1 pt. 11,405
  2. Avatar for joeyereiei 112. joeyereiei Lv 1 1 pt. 11,405
  3. Avatar for meh0192 113. meh0192 Lv 1 1 pt. 11,405
  4. Avatar for anjali.a.pillai 114. anjali.a.pillai Lv 1 1 pt. 11,405
  5. Avatar for Alyasana.Aljaizany 115. Alyasana.Aljaizany Lv 1 1 pt. 11,405
  6. Avatar for baw0060 116. baw0060 Lv 1 1 pt. 11,405
  7. Avatar for karagilleland 117. karagilleland Lv 1 1 pt. 11,405
  8. Avatar for mgd0066 118. mgd0066 Lv 1 2 pts. 11,405
  9. Avatar for crr0059 119. crr0059 Lv 1 2 pts. 11,405
  10. Avatar for aavillag 120. aavillag Lv 1 2 pts. 11,405

Comments