Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner

Summary


Created
March 20, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


  1. Avatar for Die Bigbrains 11. Die Bigbrains 1 pt. 11,405

  1. Avatar for ekm0063 132. ekm0063 Lv 1 1 pt. 11,405
  2. Avatar for als0175 133. als0175 Lv 1 1 pt. 11,405
  3. Avatar for nham_psn 134. nham_psn Lv 1 1 pt. 11,405
  4. Avatar for 42007056 135. 42007056 Lv 1 1 pt. 11,405
  5. Avatar for Sirakorn Pothipakdee 136. Sirakorn Pothipakdee Lv 1 1 pt. 11,405
  6. Avatar for tem0040 137. tem0040 Lv 1 1 pt. 11,405
  7. Avatar for Internautant 138. Internautant Lv 1 1 pt. 11,405
  8. Avatar for vishal 139. vishal Lv 1 1 pt. 11,405
  9. Avatar for xmvriax 140. xmvriax Lv 1 1 pt. 11,405

Comments