Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner

Summary


Created
March 20, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


  1. Avatar for Die Bigbrains 11. Die Bigbrains 1 pt. 11,405

  1. Avatar for Joshuamaine 41. Joshuamaine Lv 1 30 pts. 13,846
  2. Avatar for nurulainiif 42. nurulainiif Lv 1 29 pts. 13,784
  3. Avatar for zzmqmm 43. zzmqmm Lv 1 28 pts. 13,735
  4. Avatar for wildcat-fiction 44. wildcat-fiction Lv 1 27 pts. 13,662
  5. Avatar for Angel_Janny 45. Angel_Janny Lv 1 26 pts. 13,636
  6. Avatar for TenQuator 46. TenQuator Lv 1 25 pts. 13,628
  7. Avatar for Phannarai 47. Phannarai Lv 1 24 pts. 13,618
  8. Avatar for JakubW 49. JakubW Lv 1 22 pts. 13,385
  9. Avatar for Pinyada 50. Pinyada Lv 1 21 pts. 13,384

Comments