Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner

Summary


Created
March 20, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


  1. Avatar for Die Bigbrains 11. Die Bigbrains 1 pt. 11,405

  1. Avatar for yudrfuhgeuigfu 61. yudrfuhgeuigfu Lv 1 14 pts. 13,082
  2. Avatar for CDSoffice 62. CDSoffice Lv 1 13 pts. 13,058
  3. Avatar for wl99999 63. wl99999 Lv 1 13 pts. 13,031
  4. Avatar for PiMaster 64. PiMaster Lv 1 12 pts. 13,000
  5. Avatar for anonyscient 65. anonyscient Lv 1 12 pts. 12,913
  6. Avatar for shadow 66. shadow Lv 1 11 pts. 12,890
  7. Avatar for Supara 67. Supara Lv 1 11 pts. 12,783
  8. Avatar for balbal1812 68. balbal1812 Lv 1 11 pts. 12,757
  9. Avatar for szk0189 69. szk0189 Lv 1 10 pts. 12,710
  10. Avatar for Tharri35_2023 70. Tharri35_2023 Lv 1 10 pts. 12,691

Comments