Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner

Summary


Created
March 20, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


  1. Avatar for Die Bigbrains 11. Die Bigbrains 1 pt. 11,405

  1. Avatar for kyrasanders 71. kyrasanders Lv 1 9 pts. 12,682
  2. Avatar for hjg13 72. hjg13 Lv 1 9 pts. 12,635
  3. Avatar for Paula 73. Paula Lv 1 8 pts. 12,628
  4. Avatar for 334932 74. 334932 Lv 1 8 pts. 12,595
  5. Avatar for cgc0092 75. cgc0092 Lv 1 8 pts. 12,540
  6. Avatar for TMF4 76. TMF4 Lv 1 7 pts. 12,529
  7. Avatar for swb0030 77. swb0030 Lv 1 7 pts. 12,414
  8. Avatar for Songkarnp 78. Songkarnp Lv 1 7 pts. 12,368
  9. Avatar for wlopezm 79. wlopezm Lv 1 7 pts. 12,343
  10. Avatar for tsalsabila 80. tsalsabila Lv 1 6 pts. 12,303

Comments