Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner

Summary


Created
March 20, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


  1. Avatar for Die Bigbrains 11. Die Bigbrains 1 pt. 11,405

  1. Avatar for DKP1 81. DKP1 Lv 1 6 pts. 11,908
  2. Avatar for lookatdisdo0d 82. lookatdisdo0d Lv 1 6 pts. 11,891
  3. Avatar for feyhong22 83. feyhong22 Lv 1 5 pts. 11,862
  4. Avatar for athirahmohamad 84. athirahmohamad Lv 1 5 pts. 11,560
  5. Avatar for appaiscool 86. appaiscool Lv 1 5 pts. 11,534
  6. Avatar for Hazel 87. Hazel Lv 1 4 pts. 11,518
  7. Avatar for Maw0162 88. Maw0162 Lv 1 4 pts. 11,515
  8. Avatar for Br3nCast04 89. Br3nCast04 Lv 1 4 pts. 11,514
  9. Avatar for eew0046 90. eew0046 Lv 1 4 pts. 11,514

Comments