Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner

Summary


Created
March 20, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


  1. Avatar for Street Smarts 100 pts. 14,757
  2. Avatar for SHELL 2. SHELL 60 pts. 14,447
  3. Avatar for Q3 - Bioteknologi Protein 3. Q3 - Bioteknologi Protein 33 pts. 14,208
  4. Avatar for Biology 105 4. Biology 105 17 pts. 14,006
  5. Avatar for SP26 CHEM 351 Weldon 5. SP26 CHEM 351 Weldon 8 pts. 13,993
  6. Avatar for Haykapnayan 7. Haykapnayan 2 pts. 13,593
  7. Avatar for Folders 8. Folders 1 pt. 13,166
  8. Avatar for CBE_ProEn_2025 9. CBE_ProEn_2025 1 pt. 11,405
  9. Avatar for CBME5920_2022 10. CBME5920_2022 1 pt. 11,405

  1. Avatar for firaysyam
    1. firaysyam Lv 1
    0 pts. 14,208

Comments