Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner

Summary


Created
March 20, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


  1. Avatar for Street Smarts 100 pts. 14,757
  2. Avatar for SHELL 2. SHELL 60 pts. 14,447
  3. Avatar for Q3 - Bioteknologi Protein 3. Q3 - Bioteknologi Protein 33 pts. 14,208
  4. Avatar for Biology 105 4. Biology 105 17 pts. 14,006
  5. Avatar for SP26 CHEM 351 Weldon 5. SP26 CHEM 351 Weldon 8 pts. 13,993
  6. Avatar for Haykapnayan 7. Haykapnayan 2 pts. 13,593
  7. Avatar for Folders 8. Folders 1 pt. 13,166
  8. Avatar for CBE_ProEn_2025 9. CBE_ProEn_2025 1 pt. 11,405
  9. Avatar for CBME5920_2022 10. CBME5920_2022 1 pt. 11,405

  1. Avatar for Misantropi 31. Misantropi Lv 1 42 pts. 13,987
  2. Avatar for allacco95 32. allacco95 Lv 1 40 pts. 13,941
  3. Avatar for athalita 33. athalita Lv 1 39 pts. 13,941
  4. Avatar for samjs50@icloud.com 34. samjs50@icloud.com Lv 1 38 pts. 13,937
  5. Avatar for tolan_lord 35. tolan_lord Lv 1 37 pts. 13,937
  6. Avatar for cgc0079 36. cgc0079 Lv 1 35 pts. 13,917
  7. Avatar for muaims 37. muaims Lv 1 34 pts. 13,912
  8. Avatar for william.sparrow 38. william.sparrow Lv 1 33 pts. 13,905
  9. Avatar for WuWTq 39. WuWTq Lv 1 32 pts. 13,902
  10. Avatar for Dorane 40. Dorane Lv 1 31 pts. 13,884

Comments