Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Q3 - Bioteknologi Protein 11. Q3 - Bioteknologi Protein 1 pt. 8,262
  2. Avatar for Team China 12. Team China 1 pt. 7,701
  3. Avatar for SHELL 13. SHELL 1 pt. 4,879
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,695
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 10,647
  3. Avatar for gmn 3. gmn Lv 1 89 pts. 10,642
  4. Avatar for Steven Pletsch 4. Steven Pletsch Lv 1 83 pts. 10,561
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 78 pts. 10,549
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 73 pts. 10,539
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 68 pts. 10,527
  8. Avatar for silent gene 8. silent gene Lv 1 64 pts. 10,522
  9. Avatar for MicElephant 9. MicElephant Lv 1 60 pts. 10,452
  10. Avatar for hansvandenhof 10. hansvandenhof Lv 1 56 pts. 10,439

Comments