Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,699
  2. Avatar for Go Science 2. Go Science 65 pts. 10,647
  3. Avatar for Contenders 3. Contenders 41 pts. 10,452
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,378
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,214
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,051
  7. Avatar for Australia 7. Australia 4 pts. 9,972
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 9,669
  9. Avatar for VeFold 9. VeFold 1 pt. 9,321
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,264

  1. Avatar for blazegeek 11. blazegeek Lv 1 52 pts. 10,393
  2. Avatar for fpc 12. fpc Lv 1 48 pts. 10,378
  3. Avatar for Galaxie 13. Galaxie Lv 1 45 pts. 10,331
  4. Avatar for akaaka 14. akaaka Lv 1 42 pts. 10,318
  5. Avatar for g_b 15. g_b Lv 1 39 pts. 10,315
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 36 pts. 10,214
  7. Avatar for alcor29 17. alcor29 Lv 1 33 pts. 10,166
  8. Avatar for drjr 18. drjr Lv 1 31 pts. 10,156
  9. Avatar for NPrincipi 19. NPrincipi Lv 1 28 pts. 10,136
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 26 pts. 10,051

Comments