Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,699
  2. Avatar for Go Science 2. Go Science 65 pts. 10,647
  3. Avatar for Contenders 3. Contenders 41 pts. 10,452
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,378
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,214
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,051
  7. Avatar for Australia 7. Australia 4 pts. 9,972
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 9,669
  9. Avatar for VeFold 9. VeFold 1 pt. 9,321
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,264

  1. Avatar for Punzi Baker 3 21. Punzi Baker 3 Lv 1 24 pts. 10,030
  2. Avatar for BootsMcGraw 22. BootsMcGraw Lv 1 22 pts. 9,988
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 21 pts. 9,979
  4. Avatar for BackBuffer 24. BackBuffer Lv 1 19 pts. 9,976
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 17 pts. 9,972
  6. Avatar for maithra 26. maithra Lv 1 16 pts. 9,966
  7. Avatar for Vinara 27. Vinara Lv 1 15 pts. 9,925
  8. Avatar for roarshock 28. roarshock Lv 1 13 pts. 9,916
  9. Avatar for guineapig 29. guineapig Lv 1 12 pts. 9,886
  10. Avatar for ProfVince 30. ProfVince Lv 1 11 pts. 9,859

Comments